ACKR1 Antibody - N-terminal region : FITC (ARP73814_P050-FITC)

Data Sheet
 
Product Number ARP73814_P050-FITC
Product Page www.avivasysbio.com/ackr1-antibody-n-terminal-region-fitc-arp73814-p050-fitc.html
Name ACKR1 Antibody - N-terminal region : FITC (ARP73814_P050-FITC)
Protein Size (# AA) 336 amino acids
Molecular Weight 36kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2532
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name atypical chemokine receptor 1 (Duffy blood group)
Alias Symbols FY, Dfy, GPD, DARC, GpFy, CCBP1, CD234, WBCQ1, DARC/ACKR1
Peptide Sequence Synthetic peptide located within the following region: LSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions CXCL5; CCL8; CCL17; CCL5; CCL7; CCL2; CXCL1; CXCL8;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ACKR1 (ARP73814_P050-FITC) antibody
Blocking Peptide For anti-ACKR1 (ARP73814_P050-FITC) antibody is Catalog # AAP73814
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DARC
Uniprot ID Q16570
Protein Name atypical chemokine receptor 1
Protein Accession # NP_002027
Purification Affinity Purified
Gene Symbol ACKR1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com