| Product Number |
ARP73809_P050 |
| Product Page |
www.avivasysbio.com/cxcr5-antibody-n-terminal-region-arp73809-p050.html |
| Name |
CXCR5 Antibody - N-terminal region (ARP73809_P050) |
| Protein Size (# AA) |
372 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
643 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
BLR1, CD185, MDR15 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Protein Interactions |
UBC; NEDD8; CXCL13; CXCR5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CXCR5 (ARP73809_P050) antibody |
| Blocking Peptide |
For anti-CXCR5 (ARP73809_P050) antibody is Catalog # AAP73809 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CXCR5 |
| Uniprot ID |
P32302 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CXCR5 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: CXCR5
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
