COLEC11 Antibody - C-terminal region : FITC (ARP73799_P050-FITC)

• Product Number: ARP73799_P050-FITC
• Name: COLEC11 Antibody - C-terminal region : FITC (ARP73799_P050-FITC)
• Protein Size (# AA): 271 amino acids
• Molecular Weight: 29kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 78989
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: 3MC2, CLK1, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb
• Peptide Sequence: Synthetic peptide located within the following region: AQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-COLEC11 (ARP73799_P050-FITC) antibody is Catalog # AAP73799
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COLEC11
• Uniprot ID: Q9BWP8
• Purification: Affinity Purified
• Gene Symbol: COLEC11
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: