Product Number |
ARP73792_P050 |
Product Page |
www.avivasysbio.com/clcn4-antibody-n-terminal-region-arp73792-p050.html |
Name |
CLCN4 Antibody - N-terminal region (ARP73792_P050) |
Protein Size (# AA) |
760 amino acids |
Molecular Weight |
83kDa |
NCBI Gene Id |
1183 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
CLC4, ClC-4, MRX15, MRX49, ClC-4A, MRXSRC |
Peptide Sequence |
Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLCN4 (ARP73792_P050) antibody |
Blocking Peptide |
For anti-CLCN4 (ARP73792_P050) antibody is Catalog # AAP73792 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN4 |
Uniprot ID |
P51793 |
Protein Accession # |
NP_001821 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
CLCN4 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 721_B Whole Cell
| Host: Rabbit Target Name: CLCN4 Sample Type: 721_B Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|