CLCN4 Antibody - N-terminal region (ARP73792_P050)

• Product Number: ARP73792_P050
• Name: CLCN4 Antibody - N-terminal region (ARP73792_P050)
• Protein Size (# AA): 760 amino acids
• Molecular Weight: 83kDa
• NCBI Gene Id: 1183
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: CLC4, ClC-4, MRX15, MRX49, ClC-4A, MRXSRC
• Peptide Sequence: Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLCN4 (ARP73792_P050) antibody is Catalog # AAP73792
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN4
• Uniprot ID: P51793
• Protein Accession #: NP_001821
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: CLCN4
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 721_B Whole Cell
  
  Host: Rabbit
  Target Name: CLCN4
  Sample Type: 721_B Whole Cell lysates
  Antibody Dilution: 1.0ug/ml