CDCP1 Antibody - C-terminal region : FITC (ARP73783_P050-FITC)

• Product Number: ARP73783_P050-FITC
• Name: CDCP1 Antibody - C-terminal region : FITC (ARP73783_P050-FITC)
• Protein Size (# AA): 649 amino acids
• Molecular Weight: 71kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 64866
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: CD318, TRASK, SIMA135
• Peptide Sequence: Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in tumor invasion and metastasis. Alternative splicing results in multiple transcript variants of this gene.
• Protein Interactions: SDCBP; UBC; ALB; ST14; SRC; PRKCD; PLG;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CDCP1 (ARP73783_P050-FITC) antibody is Catalog # AAP73783
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDCP1
• Uniprot ID: Q9H5V8-2
• Purification: Affinity Purified
• Gene Symbol: CDCP1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: