KRT79 Antibody - C-terminal region (ARP73475_P050)

Data Sheet
 
Product Number ARP73475_P050
Product Page www.avivasysbio.com/krt79-antibody-c-terminal-region-arp73475-p050.html
Name KRT79 Antibody - C-terminal region (ARP73475_P050)
Protein Size (# AA) 535 amino acids
Molecular Weight 58kDa
NCBI Gene Id 338785
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols K6L, KRT6L
Peptide Sequence Synthetic peptide located within the following region: AQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELTRTI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in skeletal muscle, skin and scalp. The type II keratins are clustered in a region of chromosome 12q13.
Protein Interactions KRT31; KRT15; KRT13; USHBP1; KRT38; KRT33B; LGR4; BAG3; UBC; SIRT1; UBASH3B; CRK; AP2M1; CBL; PIK3R2; INPPL1; EPS15; BTRC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KRT79 (ARP73475_P050) antibody
Blocking Peptide For anti-KRT79 (ARP73475_P050) antibody is Catalog # AAP73475
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT79
Uniprot ID Q5XKE5
Protein Accession # NP_787028
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol KRT79
Predicted Species Reactivity Human
Application WB
Image 1
Human A549 Whole Cell
Host: Rabbit
Target Name: KRT79
Sample Type: A549 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com