| Product Number |
ARP73434_P050 |
| Product Page |
www.avivasysbio.com/nudcd3-antibody-middle-region-arp73434-p050.html |
| Name |
NUDCD3 Antibody - middle region (ARP73434_P050) |
| Protein Size (# AA) |
361 amino acids |
| Molecular Weight |
39 kDa |
| NCBI Gene Id |
23386 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
NudC domain containing 3 |
| Alias Symbols |
NudCL |
| Peptide Sequence |
Synthetic peptide located within the following region: AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NUDCD3 (ARP73434_P050) antibody |
| Blocking Peptide |
For Anti-NUDCD3 antibody is Catalog # AAP73434 |
| Immunogen |
The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3 |
| Uniprot ID |
Q8IVD9 |
| Protein Accession # |
NP_056147.2 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NUDCD3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Fetal Liver
 | WB Suggested Anti-NUDC3 antibody Titration: 1 ug/mL
Sample Type: Human Fetal Liver |
|
|
