| Product Number |
ARP73179_P050-HRP |
| Product Page |
www.avivasysbio.com/tmod2-antibody-n-terminal-region-hrp-arp73179-p050-hrp.html |
| Name |
TMOD2 Antibody - N-terminal region : HRP (ARP73179_P050-HRP) |
| Protein Size (# AA) |
351 amino acids |
| Molecular Weight |
38kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
29767 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
NTMOD, N-TMOD |
| Peptide Sequence |
Synthetic peptide located within the following region: TLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPV |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Description of Target |
This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Protein Interactions |
UBC; PAN2; SF3B3; SF3B2; SAFB; ABCC1; APP; TPM3; TPM1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-TMOD2 (ARP73179_P050-HRP) antibody |
| Blocking Peptide |
For anti-TMOD2 (ARP73179_P050-HRP) antibody is Catalog # AAP73179 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMOD2 |
| Uniprot ID |
Q9NZR1 |
| Purification |
Affinity Purified |
| Gene Symbol |
TMOD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 90%; Rabbit: 93%; Rat: 93% |
| Image 1 | |
|
