SENP8 Antibody - middle region : FITC (ARP73144_P050-FITC)

• Product Number: ARP73144_P050-FITC
• Name: SENP8 Antibody - middle region : FITC (ARP73144_P050-FITC)
• Protein Size (# AA): 212 amino acids
• Molecular Weight: 23kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 123228
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: DEN1, NEDP1, PRSC2
• Peptide Sequence: Synthetic peptide located within the following region: THWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.
• Protein Interactions: SMURF1; COPS2; CUL1; GPS1; RPS14; PINK1; PARK2; USP28; USP21; USP15; CUL4A; CUL2; NEDD8; UBB; PLA2G2A; AKIP1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-SENP8 (ARP73144_P050-FITC) antibody is Catalog # AAP73144
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SENP8
• Uniprot ID: Q96LD8
• Protein Accession #: XP_005254214
• Purification: Affinity Purified
• Gene Symbol: SENP8
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: