SULT4A1 Antibody - middle region (ARP73108_P050)

Data Sheet
 
Product Number ARP73108_P050
Product Page www.avivasysbio.com/sult4a1-antibody-middle-region-arp73108-p050.html
Name SULT4A1 Antibody - middle region (ARP73108_P050)
Protein Size (# AA) 260 amino acids
Molecular Weight 28kDa
NCBI Gene Id 25830
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols NST, BRSTL1, SULTX3, BR-STL-1, DJ388M5.3, hBR-STL-1
Peptide Sequence Synthetic peptide located within the following region: ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia.
Protein Interactions POT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SULT4A1 (ARP73108_P050) antibody
Blocking Peptide For anti-SULT4A1 (ARP73108_P050) antibody is Catalog # AAP73108
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SULT4A1
Uniprot ID Q9BR01-2
Protein Accession # XP_005261572
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol SULT4A1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: SULT4A1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com