Product Number |
ARP73108_P050 |
Product Page |
www.avivasysbio.com/sult4a1-antibody-middle-region-arp73108-p050.html |
Name |
SULT4A1 Antibody - middle region (ARP73108_P050) |
Protein Size (# AA) |
260 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
25830 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
NST, BRSTL1, SULTX3, BR-STL-1, DJ388M5.3, hBR-STL-1 |
Peptide Sequence |
Synthetic peptide located within the following region: ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. |
Protein Interactions |
POT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SULT4A1 (ARP73108_P050) antibody |
Blocking Peptide |
For anti-SULT4A1 (ARP73108_P050) antibody is Catalog # AAP73108 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SULT4A1 |
Uniprot ID |
Q9BR01-2 |
Protein Accession # |
XP_005261572 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
SULT4A1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: SULT4A1 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 1ug/ml |
|
|