SULT4A1 Antibody - middle region (ARP73108_P050)

Data Sheet
 
Product Number ARP73108_P050
Product Page www.avivasysbio.com/sult4a1-antibody-middle-region-arp73108-p050.html
Product Name SULT4A1 Antibody - middle region (ARP73108_P050)
Size 100 ul
Gene Symbol SULT4A1
Alias Symbols SULT4A1, SULTX3,
Protein Size (# AA) 260 amino acids
Molecular Weight 28kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 25830
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Peptide Sequence Synthetic peptide located within the following region: ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR
Description of Target This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia.
Protein Interactions POT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-SULT4A1 (ARP73108_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SULT4A1 (ARP73108_P050) antibody is Catalog # AAP73108
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SULT4A1
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SULT4A1.
Swissprot Id Q9BR01-2
Protein Accession # XP_005261572
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SULT4A1.
Replacement Item This antibody may replace item sc-129887 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: SULT4A1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com