| Product Number |
ARP73030_P050 |
| Product Page |
www.avivasysbio.com/sult1c2-antibody-n-terminal-region-arp73030-p050.html |
| Name |
SULT1C2 Antibody - N-terminal region (ARP73030_P050) |
| Protein Size (# AA) |
310 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
6819 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
ST1C1, ST1C2, SULT1C1, humSULTC2 |
| Peptide Sequence |
Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SULT1C2 is a sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Protein Interactions |
RASGRP3; HLTF; ACD; TINF2; POT1; TERF1; UBC; SULT1C2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SULT1C2 (ARP73030_P050) antibody |
| Blocking Peptide |
For anti-SULT1C2 (ARP73030_P050) antibody is Catalog # AAP73030 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SULT1C2 |
| Uniprot ID |
B4DLP0 |
| Protein Accession # |
XP_005264069 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SULT1C2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: SULT1C2
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml |
|
|
