Product Number |
ARP72984_P050-FITC |
Product Page |
www.avivasysbio.com/tesc-antibody-n-terminal-region-fitc-arp72984-p050-fitc.html |
Name |
TESC Antibody - N-terminal region : FITC (ARP72984_P050-FITC) |
Protein Size (# AA) |
214 amino acids |
Molecular Weight |
23kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
54997 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
TSC, CHP3 |
Peptide Sequence |
Synthetic peptide located within the following region: LELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. It promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner. It inhibits the phosphatase activity of calcineurin. |
Protein Interactions |
WBP11; UBC; CCDC91; HMG20A; TESC; RAI1; DYNLT3; SLC9A1; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-TESC (ARP72984_P050-FITC) antibody |
Blocking Peptide |
For anti-TESC (ARP72984_P050-FITC) antibody is Catalog # AAP72984 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TESC |
Uniprot ID |
Q96BS2 |
Protein Accession # |
NP_060369 |
Purification |
Affinity Purified |
Gene Symbol |
TESC |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|