| Product Number |
ARP72950_P050-FITC |
| Product Page |
www.avivasysbio.com/smarcal1-antibody-n-terminal-region-fitc-arp72950-p050-fitc.html |
| Name |
SMARCAL1 Antibody - N-terminal region : FITC (ARP72950_P050-FITC) |
| Protein Size (# AA) |
954 amino acids |
| Molecular Weight |
104kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
50485 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
HARP, HHARP |
| Peptide Sequence |
Synthetic peptide located within the following region: QNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGIS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency. |
| Protein Interactions |
UBC; RPA3; RPA2; RPA1; SULT1A1; Cebpb; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SMARCAL1 (ARP72950_P050-FITC) antibody |
| Blocking Peptide |
For anti-SMARCAL1 (ARP72950_P050-FITC) antibody is Catalog # AAP72950 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMARCAL1 |
| Uniprot ID |
Q9NZC9 |
| Protein Accession # |
XP_005246689 |
| Purification |
Affinity Purified |
| Gene Symbol |
SMARCAL1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
