| Product Number |
ARP72909_P050-FITC |
| Product Page |
www.avivasysbio.com/lzts1-antibody-n-terminal-region-fitc-arp72909-p050-fitc.html |
| Name |
LZTS1 Antibody - N-terminal region : FITC (ARP72909_P050-FITC) |
| Protein Size (# AA) |
596 amino acids |
| Molecular Weight |
65kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
11178 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
F37, FEZ1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer. |
| Protein Interactions |
EEF1G; CDC25C; CDK1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-LZTS1 (ARP72909_P050-FITC) antibody |
| Blocking Peptide |
For anti-LZTS1 (ARP72909_P050-FITC) antibody is Catalog # AAP72909 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1 |
| Uniprot ID |
Q9Y250 |
| Protein Accession # |
XP_005273451 |
| Purification |
Affinity Purified |
| Gene Symbol |
LZTS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | |
|
