| Product Number |
ARP72909_P050 |
| Product Page |
www.avivasysbio.com/lzts1-antibody-n-terminal-region-arp72909-p050.html |
| Name |
LZTS1 Antibody - N-terminal region (ARP72909_P050) |
| Protein Size (# AA) |
596 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
11178 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
F37, FEZ1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer. |
| Protein Interactions |
EEF1G; CDC25C; CDK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LZTS1 (ARP72909_P050) antibody |
| Blocking Peptide |
For anti-LZTS1 (ARP72909_P050) antibody is Catalog # AAP72909 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1 |
| Uniprot ID |
Q9Y250 |
| Protein Accession # |
XP_005273451 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LZTS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: LZTS1
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
