| Product Number |
ARP72695_P050-FITC |
| Product Page |
www.avivasysbio.com/nup88-antibody-middle-region-fitc-arp72695-p050-fitc.html |
| Name |
NUP88 Antibody - middle region : FITC (ARP72695_P050-FITC) |
| Protein Size (# AA) |
741 amino acids |
| Molecular Weight |
81kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
4927 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
FADS4 |
| Peptide Sequence |
Synthetic peptide located within the following region: PCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLIPSLYVFE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias. |
| Protein Interactions |
UBC; SUMO2; SUMO1; SUZ12; RNF2; ARFGEF2; FLNC; RBM42; CPSF6; CIRBP; NXF1; CAND1; CUL2; CUL3; SIRT7; Nup98; Nup214; Nup188; Obfc1; Nup88; SET; tat; RAE1; CD82; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-NUP88 (ARP72695_P050-FITC) antibody |
| Blocking Peptide |
For anti-NUP88 (ARP72695_P050-FITC) antibody is Catalog # AAP72695 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human NUP88 |
| Uniprot ID |
Q99567 |
| Protein Accession # |
NP_002523 |
| Purification |
Affinity Purified |
| Gene Symbol |
NUP88 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
