DND1 Antibody - N-terminal region : FITC (ARP72453_P050-FITC)

Data Sheet
 
Product Number ARP72453_P050-FITC
Product Page www.avivasysbio.com/dnd1-antibody-n-terminal-region-fitc-arp72453-p050-fitc.html
Name DND1 Antibody - N-terminal region : FITC (ARP72453_P050-FITC)
Protein Size (# AA) 353 amino acids
Molecular Weight 38kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 373863
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols RBMS4
Peptide Sequence Synthetic peptide located within the following region: MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a protein that binds to microRNA-targeting sequences of mRNAs, inhibiting microRNA-mediated repression. Reduced expression of this gene has been implicated in tongue squamous cell carcinoma. Two pseudogenes of this gene are located on the long arm of chromosome 17.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-DND1 (ARP72453_P050-FITC) antibody
Blocking Peptide For anti-DND1 (ARP72453_P050-FITC) antibody is Catalog # AAP72453
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human DND1
Uniprot ID Q8IYX4
Protein Accession # NP_919225
Purification Affinity Purified
Gene Symbol DND1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com