Product Number |
ARP72453_P050-FITC |
Product Page |
www.avivasysbio.com/dnd1-antibody-n-terminal-region-fitc-arp72453-p050-fitc.html |
Name |
DND1 Antibody - N-terminal region : FITC (ARP72453_P050-FITC) |
Protein Size (# AA) |
353 amino acids |
Molecular Weight |
38kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
373863 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
RBMS4 |
Peptide Sequence |
Synthetic peptide located within the following region: MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
This gene encodes a protein that binds to microRNA-targeting sequences of mRNAs, inhibiting microRNA-mediated repression. Reduced expression of this gene has been implicated in tongue squamous cell carcinoma. Two pseudogenes of this gene are located on the long arm of chromosome 17. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-DND1 (ARP72453_P050-FITC) antibody |
Blocking Peptide |
For anti-DND1 (ARP72453_P050-FITC) antibody is Catalog # AAP72453 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DND1 |
Uniprot ID |
Q8IYX4 |
Protein Accession # |
NP_919225 |
Purification |
Affinity Purified |
Gene Symbol |
DND1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|