| Product Number |
ARP72419_P050-FITC |
| Product Page |
www.avivasysbio.com/scd5-antibody-middle-region-fitc-arp72419-p050-fitc.html |
| Name |
SCD5 Antibody - middle region : FITC (ARP72419_P050-FITC) |
| Protein Size (# AA) |
256 amino acids |
| Molecular Weight |
28kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
79966 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
SCD2, SCD4, ACOD4, FADS4, HSCD5, DFNA79 |
| Peptide Sequence |
Synthetic peptide located within the following region: HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Stearoyl-CoA desaturase is an integral membrane protein of the endoplasmic reticulum that catalyzes the formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energy metabolism with a role in obesity and dislipidemia. Four SCD isoforms, Scd1 through Scd4, have been identified in mouse. In contrast, only 2 SCD isoforms, SCD1 and SCD5, have been identified in human. SCD1 shares about 85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shares limited homology with the rodent SCDs and appears to be unique to primates? |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SCD5 (ARP72419_P050-FITC) antibody |
| Blocking Peptide |
For anti-SCD5 (ARP72419_P050-FITC) antibody is Catalog # AAP72419 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SCD5 |
| Uniprot ID |
Q86SK9-2 |
| Protein Accession # |
NP_079182 |
| Purification |
Affinity Purified |
| Gene Symbol |
SCD5 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
