| Product Number |
ARP72414_P050-FITC |
| Product Page |
www.avivasysbio.com/nfatc3-antibody-n-terminal-region-fitc-arp72414-p050-fitc.html |
| Name |
NFATC3 Antibody - N-terminal region : FITC (ARP72414_P050-FITC) |
| Protein Size (# AA) |
739 amino acids |
| Molecular Weight |
81kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
4775 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
NFAT4, NFATX, NF-AT4c |
| Peptide Sequence |
Synthetic peptide located within the following region: LSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
MAPK9; MAPK8; CDK6; NCOA3; TTF1; CSNK1A1; FOS; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-NFATC3 (ARP72414_P050-FITC) antibody |
| Blocking Peptide |
For anti-NFATC3 (ARP72414_P050-FITC) antibody is Catalog # AAP72414 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC3 |
| Uniprot ID |
Q12968-6 |
| Purification |
Affinity Purified |
| Gene Symbol |
NFATC3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
