SLIT3 Antibody - N-terminal region : FITC (ARP72407_P050-FITC)

Data Sheet
 
Product Number ARP72407_P050-FITC
Product Page www.avivasysbio.com/slit3-antibody-n-terminal-region-fitc-arp72407-p050-fitc.html
Name SLIT3 Antibody - N-terminal region : FITC (ARP72407_P050-FITC)
Protein Size (# AA) 1423 amino acids
Molecular Weight 156kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 6586
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols MEGF5, SLIL2, SLIT1, slit2, Slit-3
Peptide Sequence Synthetic peptide located within the following region: LSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The protein encoded by this gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions CAPN1; ROBO2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SLIT3 (ARP72407_P050-FITC) antibody
Blocking Peptide For anti-SLIT3 (ARP72407_P050-FITC) antibody is Catalog # AAP72407
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLIT3
Uniprot ID O75094-2
Purification Affinity Purified
Gene Symbol SLIT3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com