AUH Antibody - C-terminal region : FITC (ARP72398_P050-FITC)

• Product Number: ARP72398_P050-FITC
• Name: AUH Antibody - C-terminal region : FITC (ARP72398_P050-FITC)
• Protein Size (# AA): 310 amino acids
• Molecular Weight: 34kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 549
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: AUH,
• Peptide Sequence: Synthetic peptide located within the following region: KLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: The methylglutaconyl-CoA hydratase, mitochondrial protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form.
• Protein Interactions: UBC; AUH;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-AUH (ARP72398_P050-FITC) antibody is Catalog # AAP72398
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AUH
• Uniprot ID: Q13825-2
• Protein Accession #: XP_005252125
• Purification: Affinity Purified
• Gene Symbol: AUH
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: