ALAS1 Antibody - N-terminal region : FITC (ARP72388_P050-FITC)

Data Sheet
 
Product Number ARP72388_P050-FITC
Product Page www.avivasysbio.com/alas1-antibody-n-terminal-region-fitc-arp72388-p050-fitc.html
Name ALAS1 Antibody - N-terminal region : FITC (ARP72388_P050-FITC)
Protein Size (# AA) 640 amino acids
Molecular Weight 70kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 211
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols ALAS, MIG4, ALAS3, ALASH, ALAS-H
Peptide Sequence Synthetic peptide located within the following region: RALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein Interactions FAM127C; KLHL35; ZNF564; TEKT4; DUSP19; SNX20; MTFR2; LONRF1; ZMAT1; CDC73; TTC23; CERK; SH2D4A; EP400; C2orf42; GNL3L; CCHCR1; POLDIP2; ZFYVE26; USP20; TMSB10; ZNF175; WIPF1; UBC; TMSB4XP6; TMSB4XP2; TMSB4XP1; TMSB4X; TCEA2; PPL; BCL7A; ALAS1; PLAU; VHL;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ALAS1 (ARP72388_P050-FITC) antibody
Blocking Peptide For anti-ALAS1 (ARP72388_P050-FITC) antibody is Catalog # AAP72388
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1
Uniprot ID P13196
Protein Accession # XP_005265002
Purification Affinity Purified
Gene Symbol ALAS1
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com