| Product Number |
ARP72278_P050-FITC |
| Product Page |
www.avivasysbio.com/nbpf3-antibody-n-terminal-region-fitc-arp72278-p050-fitc.html |
| Name |
NBPF3 Antibody - N-terminal region : FITC (ARP72278_P050-FITC) |
| Protein Size (# AA) |
275 amino acids |
| Molecular Weight |
30kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
84224 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
AE2 |
| Peptide Sequence |
Synthetic peptide located within the following region: CDQVKKEDQEATSPRLSRELLDEKEPEVLQDSLDRFYSTPFEYLELPDLC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene is a member of the neuroblastoma breakpoint family (NBPF) which consists of dozens of recently duplicated genes primarily located in segmental duplications on human chromosome 1. This gene family has experienced its greatest expansion within the human lineage and has expanded, to a lesser extent, among primates in general. Members of this gene family are characterized by tandemly repeated copies of DUF1220 protein domains. DUF1220 copy number variations in human chromosomal region 1q21.1, where most DUF1220 domains are located, have been implicated in a number of developmental and neurogenetic diseases such as microcephaly, macrocephaly, autism, schizophrenia, mental retardation, congenital heart disease, neuroblastoma, and congenital kidney and urinary tract anomalies. Altered expression of some gene family members is associated with several types of cancer. This gene family contains numerous pseudogenes. |
| Protein Interactions |
NBPF3; APP; UBD; UBC; TSEN15; ANK1; EWSR1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-NBPF3 (ARP72278_P050-FITC) antibody |
| Blocking Peptide |
For anti-NBPF3 (ARP72278_P050-FITC) antibody is Catalog # AAP72278 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NBPF3 |
| Uniprot ID |
Q9H094-4 |
| Purification |
Affinity Purified |
| Gene Symbol |
NBPF3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
