FOXD4L1 Antibody - N-terminal region (ARP72231_P050)

• Product Number: ARP72231_P050
• Name: FOXD4L1 Antibody - N-terminal region (ARP72231_P050)
• Protein Size (# AA): 408 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 200350
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: FOXD5, bA395L14.1
• Peptide Sequence: Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXD4L1 (ARP72231_P050) antibody is Catalog # AAP72231
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXD4L1
• Uniprot ID: Q9NU39
• Protein Accession #: NP_036316
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012184
• Tested Species Reactivity: Human
• Gene Symbol: FOXD4L1
• Predicted Species Reactivity: Human, Cow, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Human: 100%; Pig: 86%; Rabbit: 79%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: FOXD4L1
  Sample Tissue: Human Fetal Brain
  Antibody Dilution: 1ug/ml