TECPR1 Antibody - N-terminal region : FITC (ARP71734_P050-FITC)

Data Sheet
 
Product Number ARP71734_P050-FITC
Product Page www.avivasysbio.com/tecpr1-antibody-n-terminal-region-fitc-arp71734-p050-fitc.html
Name TECPR1 Antibody - N-terminal region : FITC (ARP71734_P050-FITC)
Protein Size (# AA) 776 amino acids
Molecular Weight 85kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 25851
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols TECPR1, KIAA1358,
Peptide Sequence Synthetic peptide located within the following region: YTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPSKDDPKELPDPFNDLSVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes a tethering factor involved in autophagy. The encoded protein is found at autolysosomes, and is involved in targeting protein aggregates, damaged mitochondria, and bacterial pathogens for autophagy.
Protein Interactions ATG5; ATG12; COL18A1; MCMBP; ATG3; TRAPPC11; TRAPPC12; TRAPPC8; PLOD3;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TECPR1 (ARP71734_P050-FITC) antibody
Blocking Peptide For anti-TECPR1 (ARP71734_P050-FITC) antibody is Catalog # AAP71734
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TECPR1
Uniprot ID Q7Z6L1-3
Protein Accession # XP_005250311
Purification Affinity Purified
Gene Symbol TECPR1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com