OTUD1 Antibody - C-terminal region (ARP71333_P050)

Data Sheet
 
Product Number ARP71333_P050
Product Page www.avivasysbio.com/otud1-antibody-c-terminal-region-arp71333-p050.html
Name OTUD1 Antibody - C-terminal region (ARP71333_P050)
Protein Size (# AA) 481 amino acids
Molecular Weight 51 kDa
NCBI Gene Id 220213
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols DUBA7, OTDC1
Peptide Sequence Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA7 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Protein Interactions UBC; RIPK1; USP11; RAD23B; RAD23A; FLNC; FLNB; FLNA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-OTUD1 (ARP71333_P050) antibody
Blocking Peptide For anti-OTUD1 (ARP71333_P050) antibody is Catalog # AAP71333
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTUD1
Uniprot ID Q5VV17
Protein Accession # NP_001138845
Purification Affinity Purified
Nucleotide Accession # NM_001145373
Tested Species Reactivity Human
Gene Symbol OTUD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
Image 1
Human lung, Human brain
Host: Rabbit
Target: OTUD1
Positive control (+): Human lung (LU)
Negative control (-): Human brain (BR)
Antibody concentration: 1ug/ml
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Image 3

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com