Product Number |
ARP71333_P050 |
Product Page |
www.avivasysbio.com/otud1-antibody-c-terminal-region-arp71333-p050.html |
Name |
OTUD1 Antibody - C-terminal region (ARP71333_P050) |
Protein Size (# AA) |
481 amino acids |
Molecular Weight |
51 kDa |
NCBI Gene Id |
220213 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
DUBA7, OTDC1 |
Peptide Sequence |
Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA7 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain. |
Protein Interactions |
UBC; RIPK1; USP11; RAD23B; RAD23A; FLNC; FLNB; FLNA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-OTUD1 (ARP71333_P050) antibody |
Blocking Peptide |
For anti-OTUD1 (ARP71333_P050) antibody is Catalog # AAP71333 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTUD1 |
Uniprot ID |
Q5VV17 |
Protein Accession # |
NP_001138845 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001145373 |
Tested Species Reactivity |
Human |
Gene Symbol |
OTUD1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100% |
Image 1 | Human lung, Human brain
| Host: Rabbit Target: OTUD1 Positive control (+): Human lung (LU) Negative control (-): Human brain (BR) Antibody concentration: 1ug/ml |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
Image 3 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|