Product Number |
ARP70994_P050-HRP |
Product Page |
www.avivasysbio.com/or1j4-antibody-c-terminal-region-hrp-arp70994-p050-hrp.html |
Name |
OR1J4 Antibody - C-terminal region : HRP (ARP70994_P050-HRP) |
Protein Size (# AA) |
313 amino acids |
Molecular Weight |
35kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
26219 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
OR9-21, HTPCRX01, HSHTPCRX01 |
Peptide Sequence |
Synthetic peptide located within the following region: ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Description of Target |
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-OR1J4 (ARP70994_P050-HRP) antibody |
Blocking Peptide |
For anti-OR1J4 (ARP70994_P050-HRP) antibody is Catalog # AAP70994 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1J4 |
Uniprot ID |
Q8NGS1 |
Protein Name |
Olfactory receptor 1J4 |
Protein Accession # |
NP_001004452 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001004452 |
Gene Symbol |
OR1J4 |
Predicted Species Reactivity |
Human, Rat, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100%; Pig: 86%; Rat: 86% |
Image 1 | |
|