OR1J4 Antibody - C-terminal region (ARP70994_P050)

Data Sheet
 
Product Number ARP70994_P050
Product Page www.avivasysbio.com/or1j4-antibody-c-terminal-region-arp70994-p050.html
Name OR1J4 Antibody - C-terminal region (ARP70994_P050)
Protein Size (# AA) 313 amino acids
Molecular Weight 35kDa
NCBI Gene Id 26219
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols OR9-21, HTPCRX01, HSHTPCRX01
Peptide Sequence Synthetic peptide located within the following region: ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OR1J4 (ARP70994_P050) antibody
Blocking Peptide For anti-OR1J4 (ARP70994_P050) antibody is Catalog # AAP70994
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1J4
Uniprot ID Q8NGS1
Protein Name Olfactory receptor 1J4
Protein Accession # NP_001004452
Purification Affinity Purified
Nucleotide Accession # NM_001004452
Tested Species Reactivity Human
Gene Symbol OR1J4
Predicted Species Reactivity Human, Rat, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%; Pig: 86%; Rat: 86%
Image 1
Human MDA-MB-435S
Host: Rabbit
Target Name: OR1J4
Sample Type: MDA-MB-435S Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com