NSMCE4A Antibody - C-terminal region (ARP70964_P050)

• Product Number: ARP70964_P050
• Name: NSMCE4A Antibody - C-terminal region (ARP70964_P050)
• Protein Size (# AA): 384 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 54780
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: NS4EA, NSE4A, C10orf86
• Peptide Sequence: Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: NSMCE4A is a component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). It is involved in positive regulation of response to DNA damage stimulus.
• Protein Interactions: UBC; HECW2; SRPK2; SRPK1; MAGED4B; NDNL2; MAGEC2; MAGEH1; MAGED2; NDN; MAGEB1; MAGEA1; NSMCE1; SMC6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NSMCE4A (ARP70964_P050) antibody is Catalog # AAP70964
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSMCE4A
• Uniprot ID: Q9NXX6
• Sample Type Confirmation:

  NSMCE4A is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001161337
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001167865
• Tested Species Reactivity: Human
• Gene Symbol: NSMCE4A
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Small intestine
  
  Rabbit Anti-NSMCE4A Antibody
  Catalog Number: ARP70964
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Small intestine
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  
• Image 2: Human HepG2
  
  Host: Rabbit
  Target Name: NSMCE4A
  Sample Type: HepG2 Whole Cell lysates
  Antibody Dilution: 1.0ug/mlNSMCE4A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells