N4BP2L1 Antibody - C-terminal region (ARP70916_P050)

• Product Number: ARP70916_P050
• Name: N4BP2L1 Antibody - C-terminal region (ARP70916_P050)
• Protein Size (# AA): 243 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 90634
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: CG018
• Peptide Sequence: Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-N4BP2L1 (ARP70916_P050) antibody is Catalog # AAP70916
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human N4BP2L1
• Uniprot ID: Q5TBK1
• Protein Name: NEDD4-binding protein 2-like 1
• Sample Type Confirmation:

  N4BP2L1 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226

• Protein Accession #: NP_438169
• Purification: Affinity Purified
• Nucleotide Accession #: NM_052818
• Tested Species Reactivity: Human
• Gene Symbol: N4BP2L1
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 85%; Yeast: 89%; Zebrafish: 82%
• Image 1: Human RPMI-8226
  
  Host: Rabbit
  Target Name: N4BP2L1
  Sample Type: RPMI-8226 Whole Cell lysates
  Antibody Dilution: 1.0ug/mlN4BP2L1 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226