| Product Number |
ARP70908_P050 |
| Product Page |
www.avivasysbio.com/mylk4-antibody-c-terminal-region-arp70908-p050.html |
| Name |
MYLK4 Antibody - C-terminal region (ARP70908_P050) |
| Protein Size (# AA) |
388 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
340156 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
SgK085 |
| Peptide Sequence |
Synthetic peptide located within the following region: EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
HSP90AA1; COPS5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MYLK4 (ARP70908_P050) antibody |
| Blocking Peptide |
For anti-MYLK4 (ARP70908_P050) antibody is Catalog # AAP70908 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYLK4 |
| Uniprot ID |
Q86YV6 |
| Protein Name |
Myosin light chain kinase family member 4 |
| Protein Accession # |
NP_001012418 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001012418 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MYLK4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human RPMI-8226
 | Host: Rabbit
Target Name: MYLK4
Sample Type: RPMI-8226 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
