MRPS25 Antibody - C-terminal region (ARP70896_P050)

Data Sheet
 
Product Number ARP70896_P050
Product Page www.avivasysbio.com/mrps25-antibody-c-terminal-region-arp70896-p050.html
Name MRPS25 Antibody - C-terminal region (ARP70896_P050)
Protein Size (# AA) 173 amino acids
Molecular Weight 19kDa
NCBI Gene Id 64432
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols RPMS25, COXPD50, MRP-S25
Peptide Sequence Synthetic peptide located within the following region: SHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4.
Protein Interactions CEP76; TUBGCP3; TP53; GRSF1; UBC; C1QBP; MRPS9; MRPS35; MRPS22; MRPS7; MRPS16; MRPS18B; HNRNPAB; CAND1; COPS5; MME; ICT1; DDX56;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MRPS25 (ARP70896_P050) antibody
Blocking Peptide For anti-MRPS25 (ARP70896_P050) antibody is Catalog # AAP70896
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS25
Uniprot ID P82663
Protein Name 28S ribosomal protein S25, mitochondrial
Protein Accession # NP_071942
Purification Affinity Purified
Nucleotide Accession # NM_022497
Tested Species Reactivity Human
Gene Symbol MRPS25
Predicted Species Reactivity Human, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 77%; Human: 100%; Rabbit: 85%
Image 1
Human U937
Host: Rabbit
Target Name: MRPS25
Sample Type: U937 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com