| Product Number |
ARP70877_P050 |
| Product Page |
www.avivasysbio.com/chek1-antibody-middle-region-arp70877-p050.html |
| Name |
CHEK1 Antibody - middle region (ARP70877_P050) |
| Protein Size (# AA) |
432 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
1111 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
checkpoint kinase 1 |
| Alias Symbols |
CHK1 |
| Peptide Sequence |
Synthetic peptide located within the following region: NLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHEK1 (ARP70877_P050) antibody |
| Blocking Peptide |
For anti-CHEK1 (ARP70877_P050) antibody is Catalog # AAP70877 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHEK1 |
| Uniprot ID |
O14757 |
| Protein Name |
serine/threonine-protein kinase Chk1 |
| Protein Accession # |
NP_001107593.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001114121.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHEK1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HT1080
 | Host: Rabbit
Target Name: CHEK1
Sample Type: HT1080 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
