| Product Number |
ARP70865_P050 |
| Product Page |
www.avivasysbio.com/cybb-antibody-c-terminal-region-arp70865-p050.html |
| Name |
CYBB Antibody - C-terminal region (ARP70865_P050) |
| Protein Size (# AA) |
570 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
1536 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PHOX, GP91-PHOX |
| Peptide Sequence |
Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole. |
| Protein Interactions |
IQGAP1; ACTB; UBC; SUMO1; RAC1; NCF4; NCF2; NCF1; CYBA; ACTG1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CYBB (ARP70865_P050) antibody |
| Blocking Peptide |
For anti-CYBB (ARP70865_P050) antibody is Catalog # AAP70865 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYBB |
| Uniprot ID |
P04839 |
| Protein Accession # |
NP_000388 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000397 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CYBB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 93%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | Host: Rabbit
Target Name: CYBB
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml |
|
|
