MOB3C Antibody - middle region (ARP70857_P050)

Data Sheet
 
Product Number ARP70857_P050
Product Page www.avivasysbio.com/mob3c-antibody-middle-region-arp70857-p050.html
Name MOB3C Antibody - middle region (ARP70857_P050)
Protein Size (# AA) 216 amino acids
Molecular Weight 25kDa
NCBI Gene Id 148932
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols MOB1E, MOBKL2C
Peptide Sequence Synthetic peptide located within the following region: MAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein Interactions KRT40; CMTM3; ZBTB10; FAM118A; NT5C2; TNIP1; TFCP2; TDO2; SIAH1; APP; LATS2; LATS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MOB3C (ARP70857_P050) antibody
Blocking Peptide For anti-MOB3C (ARP70857_P050) antibody is Catalog # AAP70857
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MOB3C
Uniprot ID Q70IA8
Protein Name MOB kinase activator 3C
Protein Accession # NP_958805
Purification Affinity Purified
Nucleotide Accession # NM_201403
Tested Species Reactivity Human
Gene Symbol MOB3C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human RPMI-8226
Host: Rabbit
Target Name: MOB3C
Sample Type: RPMI-8226 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com