METTL17 Antibody - C-terminal region (ARP70850_P050)

Data Sheet
 
Product Number ARP70850_P050
Product Page www.avivasysbio.com/mettl17-antibody-c-terminal-region-arp70850-p050.html
Name METTL17 Antibody - C-terminal region (ARP70850_P050)
Protein Size (# AA) 456 amino acids
Molecular Weight 51 kDa
NCBI Gene Id 64745
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols METT11D1
Peptide Sequence Synthetic peptide located within the following region: GVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target METTL17 may be a component of the mitochondrial small ribosomal subunit.
Protein Interactions TRIP6; TRAF1; SPERT; KRT40; CEP70; TFIP11; MID2; SF3B4; CALCOCO2; PNMA1; UBC; LIN28A; POP1; SUMO1; NEDD8; MDC1; ATXN1L; ATXN1; MAPK6; ICT1; MDFI;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-METTL17 (ARP70850_P050) antibody
Blocking Peptide For anti-METTL17 (ARP70850_P050) antibody is Catalog # AAP70850
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL17
Uniprot ID Q9H7H0
Protein Name Methyltransferase-like protein 17, mitochondrial
Sample Type Confirmation

METTL17 is supported by BioGPS gene expression data to be expressed in HCT15

Protein Accession # NP_073571
Purification Affinity Purified
Nucleotide Accession # NM_022734
Tested Species Reactivity Human
Gene Symbol METTL17
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 79%; Rabbit: 100%; Rat: 92%
Image 1
Human HCT15
Host: Rabbit
Target Name: METTL17
Sample Type: HCT15 Whole Cell lysates
Antibody Dilution: 1.0ug/mlMETTL17 is supported by BioGPS gene expression data to be expressed in HCT15
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com