| Product Number |
ARP70822_P050-FITC |
| Product Page |
www.avivasysbio.com/mageb10-antibody-n-terminal-region-fitc-arp70822-p050-fitc.html |
| Name |
MAGEB10 Antibody - N-terminal region : FITC (ARP70822_P050-FITC) |
| Protein Size (# AA) |
347 amino acids |
| Molecular Weight |
38kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
139422 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
MAGEB10, |
| Peptide Sequence |
Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes a member of the B subfamily of the melanoma associated antigen protein family. The encoded protein is specifically expressed in testis and tumor cells. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-MAGEB10 (ARP70822_P050-FITC) antibody |
| Blocking Peptide |
For anti-MAGEB10 (ARP70822_P050-FITC) antibody is Catalog # AAP70822 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAGEB10 |
| Uniprot ID |
Q96LZ2 |
| Protein Accession # |
NP_872312 |
| Purification |
Affinity Purified |
| Gene Symbol |
MAGEB10 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
