FAM193A Antibody - C-terminal region : Biotin (ARP70392_P050-Biotin)

Data Sheet
 
Product Number ARP70392_P050-Biotin
Product Page www.avivasysbio.com/fam193a-antibody-c-terminal-region-biotin-arp70392-p050-biotin.html
Name FAM193A Antibody - C-terminal region : Biotin (ARP70392_P050-Biotin)
Protein Size (# AA) 1265 amino acids
Molecular Weight 139kDa
Conjugation Biotin
NCBI Gene Id 8603
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols C4orf8, RES4-22
Peptide Sequence Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The function of this protein remains unknown.
Protein Interactions ANKRD28;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-FAM193A (ARP70392_P050-Biotin) antibody
Blocking Peptide For anti-FAM193A (ARP70392_P050-Biotin) antibody is Catalog # AAP70392
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
Uniprot ID P78312
Protein Name Protein FAM193A
Sample Type Confirmation

FAM193A is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_003695
Purification Affinity Purified
Nucleotide Accession # NM_003704
Gene Symbol FAM193A
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 85%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com