FAM193A Antibody - C-terminal region (ARP70392_P050)

Data Sheet
 
Product Number ARP70392_P050
Product Page www.avivasysbio.com/fam193a-antibody-c-terminal-region-arp70392-p050.html
Name FAM193A Antibody - C-terminal region (ARP70392_P050)
Protein Size (# AA) 1265 amino acids
Molecular Weight 139kDa
NCBI Gene Id 8603
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols C4orf8, RES4-22
Peptide Sequence Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions ANKRD28;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FAM193A (ARP70392_P050) antibody
Blocking Peptide For anti-FAM193A (ARP70392_P050) antibody is Catalog # AAP70392
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
Uniprot ID P78312
Protein Name Protein FAM193A
Sample Type Confirmation

FAM193A is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_003695
Purification Affinity Purified
Nucleotide Accession # NM_003704
Tested Species Reactivity Human
Gene Symbol FAM193A
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 85%
Image 1
Human 293T
Host: Rabbit
Target Name: FAM193A
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/mlFAM193A is supported by BioGPS gene expression data to be expressed in HEK293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com