Product Number |
ARP70392_P050 |
Product Page |
www.avivasysbio.com/fam193a-antibody-c-terminal-region-arp70392-p050.html |
Name |
FAM193A Antibody - C-terminal region (ARP70392_P050) |
Protein Size (# AA) |
1265 amino acids |
Molecular Weight |
139kDa |
NCBI Gene Id |
8603 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
C4orf8, RES4-22 |
Peptide Sequence |
Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
ANKRD28; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FAM193A (ARP70392_P050) antibody |
Blocking Peptide |
For anti-FAM193A (ARP70392_P050) antibody is Catalog # AAP70392 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A |
Uniprot ID |
P78312 |
Protein Name |
Protein FAM193A |
Sample Type Confirmation |
FAM193A is supported by BioGPS gene expression data to be expressed in HEK293T |
Protein Accession # |
NP_003695 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003704 |
Tested Species Reactivity |
Human |
Gene Symbol |
FAM193A |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 85% |
Image 1 | Human 293T
| Host: Rabbit Target Name: FAM193A Sample Type: 293T Whole Cell lysates Antibody Dilution: 1.0ug/mlFAM193A is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|