CWF19L1 Antibody - N-terminal region (ARP70079_P050)

• Product Number: ARP70079_P050
• Name: CWF19L1 Antibody - N-terminal region (ARP70079_P050)
• Protein Size (# AA): 293 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 55280
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CWF19-like 1, cell cycle control (S. pombe)
• Alias Symbols: C19L1, hDrn1, SCAR17
• Peptide Sequence: Synthetic peptide located within the following region: ENPYRKSGQEASIGKQILAPVEESACQFFFDLNEKQGRKRSSTGRDSKSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the CWF19 protein family. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia-17 and mild mental retardation. Alternative splicing results in multiple transcript variants.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CWF19L1 (ARP70079_P050) antibody is Catalog # AAP70079
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CWF19L1
• Uniprot ID: D3DR67
• Protein Name: CWF19-like protein 1
• Protein Accession #: NP_001290336.1
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001303407.1
• Tested Species Reactivity: Human
• Gene Symbol: CWF19L1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Hela
  
  Host: Rabbit
  Target Name: CWF19L1
  Sample Type: Hela Whole cell lysates
  Antibody Dilution: 1.0ug/ml