MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)

Data Sheet
 
Product Number ARP70076_P050-FITC
Product Page www.avivasysbio.com/mia2-antibody-middle-region-fitc-arp70076-p050-fitc.html
Name MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)
Protein Size (# AA) 672 amino acids
Molecular Weight 73kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 4253
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MIA SH3 domain ER export factor 2
Alias Symbols MEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11
Peptide Sequence Synthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene encodes s receptor in the endoplasmic reticulum, which plays a role in the export of large pre-chylomicrons and pre-very low density lipoproteins (pre-VLDLs). Three major classes of transcripts are generated from this gene- melanoma inhibitory activity 2-specific transcripts, cTAGE family member 5-specific transcripts and transcripts that include exons from both these transcript species (TANGO1-like or TALI). Additionally, alternative splicing in these transcripts results in multiple transcript variants encoding multiple isoforms.
Protein Interactions RASAL2; PSMA3; AES; MAGEB18; TTC23L; CCHCR1; SS18L1; EMILIN1; CEP57; DGCR6; Dlg4; UBC; GRB2; ALB;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MIA2 (ARP70076_P050-FITC) antibody
Blocking Peptide For anti-MIA2 (ARP70076_P050-FITC) antibody is Catalog # AAP70076
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5
Uniprot ID O15320-9
Protein Name cTAGE family member 5; melanoma inhibitory activity protein 2
Purification Affinity Purified
Gene Symbol MIA2
Predicted Species Reactivity Human, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 92%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com