Product Number |
ARP70067_P050 |
Product Page |
www.avivasysbio.com/csrnp3-antibody-n-terminal-region-arp70067-p050.html |
Name |
CSRNP3 Antibody - N-terminal region (ARP70067_P050) |
Protein Size (# AA) |
526 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
80034 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
TAIP2, TAIP-2, PPP1R73, FAM130A2 |
Peptide Sequence |
Synthetic peptide located within the following region: KMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
CSRNP3 binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. It plays a role in apoptosis. |
Protein Interactions |
PPP1CA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CSRNP3 (ARP70067_P050) antibody |
Blocking Peptide |
For anti-CSRNP3 (ARP70067_P050) antibody is Catalog # AAP70067 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CSRNP3 |
Uniprot ID |
Q8WYN3-2 |
Protein Name |
Cysteine/serine-rich nuclear protein 3 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
CSRNP3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83% |
Image 1 | Human Jurkat
| Host: Rabbit Target Name: CSRNP3 Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|