CSRNP3 Antibody - N-terminal region (ARP70067_P050)

Data Sheet
 
Product Number ARP70067_P050
Product Page www.avivasysbio.com/csrnp3-antibody-n-terminal-region-arp70067-p050.html
Name CSRNP3 Antibody - N-terminal region (ARP70067_P050)
Protein Size (# AA) 526 amino acids
Molecular Weight 57kDa
NCBI Gene Id 80034
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols TAIP2, TAIP-2, PPP1R73, FAM130A2
Peptide Sequence Synthetic peptide located within the following region: KMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target CSRNP3 binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. It plays a role in apoptosis.
Protein Interactions PPP1CA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CSRNP3 (ARP70067_P050) antibody
Blocking Peptide For anti-CSRNP3 (ARP70067_P050) antibody is Catalog # AAP70067
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CSRNP3
Uniprot ID Q8WYN3-2
Protein Name Cysteine/serine-rich nuclear protein 3
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol CSRNP3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Image 1
Human Jurkat
Host: Rabbit
Target Name: CSRNP3
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com