CSRNP2 Antibody - C-terminal region (ARP70064_P050)

• Product Number: ARP70064_P050
• Name: CSRNP2 Antibody - C-terminal region (ARP70064_P050)
• Protein Size (# AA): 543 amino acids
• Molecular Weight: 59kDa
• NCBI Gene Id: 81566
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1
• Peptide Sequence: Synthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
• Protein Interactions: PPP1CC; PPP1CB; PPP1CA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CSRNP2 (ARP70064_P050) antibody is Catalog # AAP70064
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2
• Uniprot ID: Q9H175
• Protein Name: Cysteine/serine-rich nuclear protein 2
• Protein Accession #: NP_110436
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030809
• Tested Species Reactivity: Human
• Gene Symbol: CSRNP2
• Predicted Species Reactivity: Human, Rat, Dog, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Human: 100%; Rabbit: 75%; Rat: 83%
• Image 1: Human THP-1
  
  Host: Rabbit
  Target Name: CSRNP2
  Sample Type: THP-1 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml