CORO7 Antibody - N-terminal region : FITC (ARP70058_P050-FITC)

Data Sheet
 
Product Number ARP70058_P050-FITC
Product Page www.avivasysbio.com/coro7-antibody-n-terminal-region-fitc-arp70058-p050-fitc.html
Name CORO7 Antibody - N-terminal region : FITC (ARP70058_P050-FITC)
Protein Size (# AA) 840 amino acids
Molecular Weight 92kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 79585
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols CRN7, POD1, 0610011B16Rik
Peptide Sequence Synthetic peptide located within the following region: RDGALVGTACKDKQLRIFDPRTKPRASQSTQAHENSRDSRLAWMGTWEHL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target CORO7 may play a role in the maintenance of the Golgi apparatus morphology and in the protein export from the Golgi.
Protein Interactions TOB1; UBC; ZRANB1; KLHL20; JUN; EPS15; ACTB; DAG1; RBX1; CUL1; TCEB2; TCEB1; CDC34;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CORO7 (ARP70058_P050-FITC) antibody
Blocking Peptide For anti-CORO7 (ARP70058_P050-FITC) antibody is Catalog # AAP70058
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CORO7
Uniprot ID P57737-2
Purification Affinity Purified
Gene Symbol CORO7
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com