COPZ1 Antibody - middle region (ARP70054_P050)

• Product Number: ARP70054_P050
• Name: COPZ1 Antibody - middle region (ARP70054_P050)
• Protein Size (# AA): 198 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 22818
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: coatomer protein complex subunit zeta 1
• Alias Symbols: COPZ, CGI-120, HSPC181, zeta-COP, zeta1-COP
• Peptide Sequence: Synthetic peptide located within the following region: YTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-COPZ1 (ARP70054_P050) antibody is Catalog # AAP70054
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COPZ1
• Uniprot ID: P61923
• Protein Name: coatomer subunit zeta-1
• Protein Accession #: NP_001258663.1
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001271734.1
• Tested Species Reactivity: Human
• Gene Symbol: COPZ1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human COLO205
  
  Host: Rabbit
  Target Name: COPZ1
  Sample Type: COLO205 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml