CNOT10 Antibody - C-terminal region (ARP70040_P050)

Data Sheet
 
Product Number ARP70040_P050
Product Page www.avivasysbio.com/cnot10-antibody-c-terminal-region-arp70040-p050.html
Name CNOT10 Antibody - C-terminal region (ARP70040_P050)
Protein Size (# AA) 717 amino acids
Molecular Weight 79kDa
NCBI Gene Id 25904
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Peptide Sequence Synthetic peptide located within the following region: NVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions RNF219; HECW2; PPP6R1; LYN; CNOT6L; CNOT6; UBC; VCP; EPAS1; CHMP1B; Cnot3; USP22; CNOT8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CNOT10 (ARP70040_P050) antibody
Blocking Peptide For anti-CNOT10 (ARP70040_P050) antibody is Catalog # AAP70040
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CNOT10
Uniprot ID Q9H9A5-3
Protein Name CCR4-NOT transcription complex subunit 10
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol CNOT10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human PANC1
Host: Rabbit
Target Name: CNOT10
Sample Type: PANC1 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com