CENPT Antibody - C-terminal region (ARP70015_P050)

Data Sheet
 
Product Number ARP70015_P050
Product Page www.avivasysbio.com/cenpt-antibody-c-terminal-region-arp70015-p050.html
Name CENPT Antibody - C-terminal region (ARP70015_P050)
Protein Size (# AA) 561 amino acids
Molecular Weight 60kDa
NCBI Gene Id 80152
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols SSMGA, CENP-T, C16orf56
Peptide Sequence Synthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA replaces histone H3. CENPT is an additional factor required for centromere assembly.
Protein Interactions CENPW; COPS5; UBC; CENPM; CENPA; APP; CENPU; TCEA2; PPCDC; DHX29; SNCB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CENPT (ARP70015_P050) antibody
Blocking Peptide For anti-CENPT (ARP70015_P050) antibody is Catalog # AAP70015
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human CENPT
Uniprot ID Q96BT3
Protein Name Centromere protein T
Sample Type Confirmation

CENPT is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_079358
Purification Affinity Purified
Nucleotide Accession # NM_025082
Tested Species Reactivity Human
Gene Symbol CENPT
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 85%; Rabbit: 92%; Rat: 100%
Image 1
Human HepG2
Host: Rabbit
Target Name: CENPT
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/mlCENPT is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com