Product Number |
ARP70015_P050 |
Product Page |
www.avivasysbio.com/cenpt-antibody-c-terminal-region-arp70015-p050.html |
Name |
CENPT Antibody - C-terminal region (ARP70015_P050) |
Protein Size (# AA) |
561 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
80152 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
SSMGA, CENP-T, C16orf56 |
Peptide Sequence |
Synthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA replaces histone H3. CENPT is an additional factor required for centromere assembly. |
Protein Interactions |
CENPW; COPS5; UBC; CENPM; CENPA; APP; CENPU; TCEA2; PPCDC; DHX29; SNCB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CENPT (ARP70015_P050) antibody |
Blocking Peptide |
For anti-CENPT (ARP70015_P050) antibody is Catalog # AAP70015 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CENPT |
Uniprot ID |
Q96BT3 |
Protein Name |
Centromere protein T |
Sample Type Confirmation |
CENPT is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_079358 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025082 |
Tested Species Reactivity |
Human |
Gene Symbol |
CENPT |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 85%; Rabbit: 92%; Rat: 100% |
Image 1 | Human HepG2
| Host: Rabbit Target Name: CENPT Sample Type: HepG2 Whole Cell lysates Antibody Dilution: 1.0ug/mlCENPT is supported by BioGPS gene expression data to be expressed in HepG2 |
|
|