| Product Number |
ARP69998_P050 |
| Product Page |
www.avivasysbio.com/ptpn20a-antibody-middle-region-arp69998-p050.html |
| Name |
PTPN20A Antibody - middle region (ARP69998_P050) |
| Protein Size (# AA) |
339 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
653129 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CT126, PTPN20B, hPTPN20, bA142I17.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more centromeric copy, PTPN20A. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PTPN20A (ARP69998_P050) antibody |
| Blocking Peptide |
For anti-PTPN20A (ARP69998_P050) antibody is Catalog # AAP69998 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human PTPN20A |
| Uniprot ID |
Q4JDL3-4 |
| Protein Name |
Tyrosine-protein phosphatase non-receptor type 20 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PTPN20A |
| Predicted Species Reactivity |
Human, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 79%; Zebrafish: 77% |
| Image 1 | Human MCF7
 | Host: Rabbit
Target Name: PTPN20A
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
