| Product Number |
ARP69964_P050 |
| Product Page |
www.avivasysbio.com/alg1l2-antibody-c-terminal-region-arp69964-p050.html |
| Name |
ALG1L2 Antibody - C-terminal region (ARP69964_P050) |
| Protein Size (# AA) |
279 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
644974 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase-like 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALG1L2 (ARP69964_P050) antibody |
| Blocking Peptide |
For anti-ALG1L2 (ARP69964_P050) antibody is Catalog # AAP69964 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1L2 |
| Uniprot ID |
C9J202 |
| Protein Name |
putative glycosyltransferase ALG1L2 |
| Protein Accession # |
NP_001129624.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001136152.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALG1L2 |
| Predicted Species Reactivity |
Human, Rat, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 79%; Rabbit: 79%; Rat: 91% |
| Image 1 | Human COLO205
 | Host: Rabbit
Target Name: OR7E86P
Sample Type: COLO205 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
