| Product Number |
ARP69038_P050 |
| Product Page |
www.avivasysbio.com/fam222a-antibody-n-terminal-region-arp69038-p050.html |
| Name |
FAM222A Antibody - N-terminal region (ARP69038_P050) |
| Protein Size (# AA) |
452 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
84915 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Description |
|
| Alias Symbols |
C12orf34 |
| Peptide Sequence |
Synthetic peptide located within the following region: PQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
NLK; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FAM222A (ARP69038_P050) antibody |
| Blocking Peptide |
For anti-FAM222A (ARP69038_P050) antibody is Catalog # AAP69038 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM222A |
| Uniprot ID |
Q5U5X8 |
| Protein Name |
Protein FAM222A |
| Publications |
FAM222A encodes a protein which accumulates in plaques in Alzheimer's disease. Nat Commun. 11, 411 (2020). 31964863 |
| Protein Accession # |
NP_116218 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032829 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FAM222A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Image 1 | Human 293T
 | Host: Rabbit
Target Name: FAM222A
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
